DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33932 and Pop7

DIOPT Version :10

Sequence 1:NP_001027079.1 Gene:CG33932 / 338392 FlyBaseID:FBgn0066303 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001099388.1 Gene:Pop7 / 288564 RGDID:1306413 Length:140 Species:Rattus norvegicus


Alignment Length:32 Identity:11/32 - (34%)
Similarity:16/32 - (50%) Gaps:3/32 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EILVNLCGLLVFTITLTVKLHLQARAGPGGIL 48
            ||.::..||   .|...:.:.||.:||..|.|
  Rat    68 EIYIHGLGL---AINRAINIALQLQAGSFGSL 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33932NP_001027079.1 TMEM203 2..144 CDD:439364 11/32 (34%)
Pop7NP_001099388.1 Rpp20 33..133 CDD:372048 11/32 (34%)

Return to query results.
Submit another query.