DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33932 and T07A9.12

DIOPT Version :9

Sequence 1:NP_001027079.1 Gene:CG33932 / 338392 FlyBaseID:FBgn0066303 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001380072.1 Gene:T07A9.12 / 176867 WormBaseID:WBGene00020299 Length:145 Species:Caenorhabditis elegans


Alignment Length:158 Identity:42/158 - (26%)
Similarity:75/158 - (47%) Gaps:26/158 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLSELVRWLGLTEFEILVNLCGLLVFTITLTVKLHLQARAGPGGILPEPMG-DWFTVFSPLFF 64
            :..|.|:..|..:|.||:.|:...::|.::.|.:|||            |.:. .:..|.||| |
 Worm     3 LLTLREMTTWFDITLFELWVHFAAIIVSSVMLCLKLH------------ETVSISYMWVASPL-F 54

  Fly    65 IDICNAYFCV-IVGIRMYLDSNNKRKALHRFMWSTYFLVLIAIFKYLLCLKLSSKTGLEYSE--- 125
            :.:..:||.| |:.:|..::..:.|....|.:.:.:.|..|.:|.|.:..|:|.:  ||.||   
 Worm    55 VGLAFSYFFVFIIYLRSCVEFKDYRGPTVRVILNIFRLTCITLFIYFIVEKISGE--LEKSEVAN 117

  Fly   126 ------VFSPIFVLLQLVAVRACQLPNS 147
                  ||.|:::||.....:.|:..|:
 Worm   118 RNTYGMVFLPMWLLLASWGFQMCRATNN 145



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I4122
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48984
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109645
Panther 1 1.100 - - LDO PTHR13568
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5244
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.