DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33932 and POP7

DIOPT Version :9

Sequence 1:NP_001027079.1 Gene:CG33932 / 338392 FlyBaseID:FBgn0066303 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_005828.2 Gene:POP7 / 10248 HGNCID:19949 Length:140 Species:Homo sapiens


Alignment Length:32 Identity:11/32 - (34%)
Similarity:16/32 - (50%) Gaps:3/32 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EILVNLCGLLVFTITLTVKLHLQARAGPGGIL 48
            ||.::..||   .|...:.:.||.:||..|.|
Human    68 EIYIHGLGL---AINRAINIALQLQAGSFGSL 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33932NP_001027079.1 None
POP7NP_005828.2 Rpp20 33..133 CDD:372048 11/32 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.