powered by:
Protein Alignment CG33932 and POP7
DIOPT Version :9
Sequence 1: | NP_001027079.1 |
Gene: | CG33932 / 338392 |
FlyBaseID: | FBgn0066303 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_005828.2 |
Gene: | POP7 / 10248 |
HGNCID: | 19949 |
Length: | 140 |
Species: | Homo sapiens |
Alignment Length: | 32 |
Identity: | 11/32 - (34%) |
Similarity: | 16/32 - (50%) |
Gaps: | 3/32 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 EILVNLCGLLVFTITLTVKLHLQARAGPGGIL 48
||.::..|| .|...:.:.||.:||..|.|
Human 68 EIYIHGLGL---AINRAINIALQLQAGSFGSL 96
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33932 | NP_001027079.1 |
None |
POP7 | NP_005828.2 |
Rpp20 |
33..133 |
CDD:372048 |
11/32 (34%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3631 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.