| Sequence 1: | NP_608978.2 | Gene: | Gal / 33839 | FlyBaseID: | FBgn0001089 | Length: | 672 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_190873.1 | Gene: | AT3G53050 / 824471 | AraportID: | AT3G53050 | Length: | 142 | Species: | Arabidopsis thaliana |
| Alignment Length: | 42 | Identity: | 10/42 - (23%) |
|---|---|---|---|
| Similarity: | 15/42 - (35%) | Gaps: | 13/42 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 206 DYACDHDYLNWLRDETEKYVSGKALLFTVDIPNEKMSCGKIE 247 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Gal | NP_608978.2 | Glyco_hydro_35 | 54..376 | CDD:396048 | 10/42 (24%) |
| BetaGal_dom4_5 | <570..637 | CDD:463857 | |||
| AT3G53050 | NP_190873.1 | Gal_Rha_Lectin_BGal | 73..141 | CDD:438699 | 10/42 (24%) |
| Blue background indicates that the domain is not in the aligned region. | |||||