DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gal and AT3G53050

DIOPT Version :10

Sequence 1:NP_608978.2 Gene:Gal / 33839 FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_190873.1 Gene:AT3G53050 / 824471 AraportID:AT3G53050 Length:142 Species:Arabidopsis thaliana


Alignment Length:42 Identity:10/42 - (23%)
Similarity:15/42 - (35%) Gaps:13/42 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 DYACDHDYLNWLRDETEKYVSGKALLFTVDIPNEKMSCGKIE 247
            |:.|:           :.||..|  :...|......||||.:
plant    74 DFDCE-----------QGYVISK--ITYADYGQSTGSCGKFK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:396048 10/42 (24%)
BetaGal_dom4_5 <570..637 CDD:463857
AT3G53050NP_190873.1 Gal_Rha_Lectin_BGal 73..141 CDD:438699 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.