DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gal and AT2G04060

DIOPT Version :9

Sequence 1:NP_608978.2 Gene:Gal / 33839 FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_178493.1 Gene:AT2G04060 / 814940 AraportID:AT2G04060 Length:469 Species:Arabidopsis thaliana


Alignment Length:416 Identity:95/416 - (22%)
Similarity:134/416 - (32%) Gaps:176/416 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 MFFGGTNFGFTAGANYNLDGGIGYAADITSYDYDAVMDEAGGVTTKYNLVKAVIGEFLPLPEITL 386
            |:.|.|||..|||..:          ..|:|||||.:||.|      ||.:...|....|.::..
plant    23 MYHGHTNFDRTAGGPF----------ITTTYDYDAPLDEFG------NLNQPKYGHLKQLHDVFH 71

  Fly   387 NPAKRLAYGRVELTP-----KLTLLSTEGRAALSKGD--------------PV--ESIKP----- 425
            ...|.|.||.:....     ..|:..||..::...|:              |.  .||.|     
plant    72 AMEKTLTYGNISTADFGNLVMTTVYQTEEGSSCFIGNVNAKINFQGTSYDVPAWYVSILPDCKTE 136

  Fly   426 --KTFEELDLYSGL------------VLYETELPSMDLDPALLK--IDQINDRAHV---FVDQEL 471
              .|.:.:.|.:.|            :.|.|.:...:.|||..|  ..:||..|||   ||:.:.
plant   137 SYNTAKRMKLRTSLRFKNVSNDESDFLWYMTTVNLKEQDPAWGKNMSLRINSTAHVLHGFVNGQH 201

  Fly   472 VGTLSREAQIYSLPLSKGWGSTLQLLVENQGRVNFYISNDTK----------------------- 513
            .|...                     ||| |:.::....|.|                       
plant   202 TGNYR---------------------VEN-GKFHYVFEQDAKFNPGVNVITLLSVTVDLPNYGAF 244

  Fly   514 ------GIFGEVSLQLHNGG-----YLPLENWRSTAFPLEQSAVELWRREHTDEKALDPLLARQR 567
                  ||.|.|.:...||.     ||...|          .|.:|     |..||  ||     
plant   245 FENVPAGITGPVFIIGRNGDETVVKYLSTHN----------GATKL-----TIFKA--PL----- 287

  Fly   568 ILRNGPILYTGSLTVTEVGDTYLNMAGWGKGVAYVNGFNLGRYWPVAGPQVTL------------ 620
                      ||..|.      :::.|:|||.|.:|....|||||  .|.|.|            
plant   288 ----------GSEPVV------VDLLGFGKGKASINENYTGRYWP--DPPVLLRFSTHLLHNWVL 334

  Fly   621 ------YVPNEIL-KVGENSLVILEY 639
                  ||.:|:: :..:|..:||::
plant   335 ASSPYRYVMSELISQYAKNLAIILKH 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 19/53 (36%)
BetaGal_dom4_5 <570..637 CDD:290101 21/85 (25%)
AT2G04060NP_178493.1 PLN03059 <1..>316 CDD:166698 84/368 (23%)
AmyAc_family <23..67 CDD:298606 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1874
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D179316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.