DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gal and AT2G04062

DIOPT Version :9

Sequence 1:NP_608978.2 Gene:Gal / 33839 FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001324229.1 Gene:AT2G04062 / 28717542 AraportID:AT2G04062 Length:158 Species:Arabidopsis thaliana


Alignment Length:163 Identity:42/163 - (25%)
Similarity:78/163 - (47%) Gaps:28/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IDHEANTFMLDGQPFRYVSGSFHYFRAVPESWRSRLRTMRASGLNALDTYVEWSLHNPHDGEYNW 112
            :.|:.....:.|.....:|||.|||.:..|.|.:.::..:..||:|::|||.|:.|.|...:|::
plant     7 VSHDGCAITIYGHRRVLLSGSIHYFCSTDEMWPNLIKKGKERGLDAIETYVFWNAHEPTRRQYDF 71

  Fly   113 EGIADVVKFLEIAQEE----DFYIILRPGPYICAERDNGGLPHWLFTKYPSIKMRTNDPNYISEV 173
            .|..|::.|....|.|    :||.:    .::.|   :..:..|:. ..|.|:.||.:..:::| 
plant    72 SGNLDLILFFRTIQNEGICMEFYAL----DHMFA---HSRITVWVH-NMPIIEFRTTNTAFMNE- 127

  Fly   174 GKWYAELMPRLQHLFVGNGGKIIMVQVENEYGD 206
                      :|:|..     :|:..:|||||:
plant   128 ----------MQNLTT-----MIIEMIENEYGN 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624 41/157 (26%)
BetaGal_dom4_5 <570..637 CDD:290101
AT2G04062NP_001324229.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D179316at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.