DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gal and b3gat1b

DIOPT Version :9

Sequence 1:NP_608978.2 Gene:Gal / 33839 FlyBaseID:FBgn0001089 Length:672 Species:Drosophila melanogaster
Sequence 2:XP_002663665.1 Gene:b3gat1b / 100332644 ZFINID:ZDB-GENE-131101-1 Length:336 Species:Danio rerio


Alignment Length:135 Identity:32/135 - (23%)
Similarity:48/135 - (35%) Gaps:33/135 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   546 VELWRREHTDEKALDPLL------------ARQRILR-NGPILYTGS--LTVTEVGDTYLNMAGW 595
            :.||.     ::|.:|||            |.||..| ..|.|....  ..||.:...:.....|
Zfish    21 ITLWH-----QRAGNPLLPIPRDNRTGTSKAHQRSFRLQKPCLSENKHIPEVTRMKSIHSRSPAW 80

  Fly   596 GKGVAYVNGFNLGRYWPVAGPQVT------LYVPNEILKVGENS-----LV--ILEYQRANKTAT 647
            ...:..::........||...::|      |:|||....:.|:|     ||  :||..|.|.|..
Zfish    81 SNALPTLHIITPTYSRPVQKAELTRLANTLLHVPNLHWLLVEDSAQKTPLVSRLLENSRLNYTHL 145

  Fly   648 GEDLP 652
            ..:.|
Zfish   146 NVETP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalNP_608978.2 Glyco_hydro_35 54..376 CDD:279624
BetaGal_dom4_5 <570..637 CDD:290101 17/82 (21%)
b3gat1bXP_002663665.1 Glyco_transf_43 106..315 CDD:281369 14/45 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.