DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and AT2G20230

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_565468.1 Gene:AT2G20230 / 816542 AraportID:AT2G20230 Length:270 Species:Arabidopsis thaliana


Alignment Length:195 Identity:44/195 - (22%)
Similarity:77/195 - (39%) Gaps:70/195 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SCCLKYLLFAS--NVILWLSALLVLSV---GIW----------------AWSEKGMFRNIAR--- 56
            :||  ::.|||  .::.::.|.:.:|:   .||                |.|..|  ..||.   
plant     4 NCC--HVSFASTLKILNFVQAFIGVSIIIYSIWMLHEYSRHLPVDPPPSASSSSG--TEIATSVS 64

  Fly    57 ------LHFIA-----------------LD---PAFV--LIILGGVTFLLGFMGSVGALRENTCL 93
                  :.|:|                 ||   |.|:  .:.:|.:..::.|:|.:.|...|.|.
plant    65 EPLKNPIDFVASIILGSNGGDHGFNLRSLDLPAPWFIYSFMAVGILVCIVTFIGFIAAEAINGCC 129

  Fly    94 LGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATE------GLKAFIRHYREDADQQNLIDWI 152
            |..|:|..::|::.|...  ||::..|:.|.||...:      .|:|||   .|:.|   :..|:
plant   130 LCFYSILKTLLILLEAAL--VAYIAIDRHWEKDLPYDPTGELSSLRAFI---EENID---ICKWV 186

  Fly   153  152
            plant   187  186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 43/193 (22%)
DUF2207 <65..157 CDD:303056 25/96 (26%)
TM4SF9_like_LEL 118..239 CDD:239412 11/41 (27%)
AT2G20230NP_565468.1 Tetraspannin 85..>164 CDD:395265 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1180379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.