DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and TSPAN14

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_011538521.1 Gene:TSPAN14 / 81619 HGNCID:23303 Length:284 Species:Homo sapiens


Alignment Length:324 Identity:120/324 - (37%)
Similarity:173/324 - (53%) Gaps:61/324 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FRRETSEISCCLKYLLFASNVILW--------------LSALLVLSVGIWAWSEKGMFRN---IA 55
            :|...:::||..|||||:.|:|.|              |:.::.|.||:|||||||:..:   :.
Human     4 YRYSNAKVSCWYKYLLFSYNIIFWGHLRLKEFVQIFRKLAGVVFLGVGLWAWSEKGVLSDLTKVT 68

  Fly    56 RLHFIALDPAFVLIILGGVTFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKD 120
            |:|  .:||..:::::|.|.|.|||.|.|||||||.|||..:...:.::...|:....:||:.:|
Human    69 RMH--GIDPVVLVLMVGVVMFTLGFAGCVGALRENICLLNFFCGTIVLIFFLELAVAVLAFLFQD 131

  Fly   121 KGWIKDQATEGLKAFIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSRE 185
              |::|:..|..::.|:.||:|.|.|||||.:|:. .||||..||:|||.|.|||||. |..|||
Human   132 --WVRDRFREFFESNIKSYRDDIDLQNLIDSLQKA-NQCCGAYGPEDWDLNVYFNCSG-ASYSRE 192

  Fly   186 ACGVPFSCCRRRPQEVIKNKQCGYDVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALL 250
            .||||||||...|.:.:.|.|||||||               ::....|.|:             
Human   193 KCGVPFSCCVPDPAQKVVNTQCGYDVR---------------IQLKSKWDES------------- 229

  Fly   251 VLQGMELSKIIYEKGCVQAGEEWMEHNLIIISATVIVVMFFQILGICFAQNLRADIYTQKSKWH 314
                      |:.|||:||.|.|:..|:.|::...|.:...||.||..|:.|.:||...|:..|
Human   230 ----------IFTKGCIQALESWLPRNIYIVAGVFIAISLLQIFGIFLARTLISDIEAVKAGHH 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 96/251 (38%)
DUF2207 <65..157 CDD:303056 35/91 (38%)
TM4SF9_like_LEL 118..239 CDD:239412 53/120 (44%)
TSPAN14XP_011538521.1 TM4SF9_like_LEL 127..247 CDD:239412 62/161 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2780
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3402
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48585
OrthoDB 1 1.010 - - D1180379at2759
OrthoFinder 1 1.000 - - FOG0001766
OrthoInspector 1 1.000 - - otm41913
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X349
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.