DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tspan15

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_932113.2 Gene:Tspan15 / 70423 MGIID:1917673 Length:294 Species:Mus musculus


Alignment Length:298 Identity:88/298 - (29%)
Similarity:146/298 - (48%) Gaps:61/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RRETSEISCC-------LKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAF 66
            |.::.::..|       ||:.|...:.:.||...|||||||:|.:|:..::.:... |:|  ||.
Mouse     3 RGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGGLVLSVGIYAEAERQKYKTLESA-FLA--PAI 64

  Fly    67 VLIILGGVTFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEI--GFCAVAFVLKDKGWIKDQAT 129
            :||:||.|.|::.|:|.:.:||:|.|||.::...|.:.|:.|:  |..|:.|..:...::.|...
Mouse    65 ILILLGVVMFIVSFIGVLASLRDNLCLLQSFMYILGICLVMELIGGIVALIFRNQTIDFLNDNIR 129

  Fly   130 EGLKAFIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCC 194
            .|    |.:|.:|.|.:|::|::|:.: :|||.:..:||..|.|.:||  |.|.. |||||::||
Mouse   130 RG----IENYYDDLDFKNIMDFVQKKF-KCCGGEDYRDWSKNQYHDCS--APGPL-ACGVPYTCC 186

  Fly   195 RRRPQEVIKNKQCGY-DVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMELS 258
            .|...:|: |..||| .:.||.......||.|||..                  |:|:       
Mouse   187 IRNTTDVV-NTMCGYKTIDKERLNAQNIIHVRGCTN------------------AVLI------- 225

  Fly   259 KIIYEKGCVQAGEEWMEHNLIIISATVIVVMFFQILGI 296
                          |...|..|::..::.::..|.||:
Mouse   226 --------------WFMDNYTIMAGLLLGILLPQFLGV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 81/244 (33%)
DUF2207 <65..157 CDD:303056 30/93 (32%)
TM4SF9_like_LEL 118..239 CDD:239412 40/121 (33%)
Tspan15NP_932113.2 Tetraspannin 19..256 CDD:278750 86/282 (30%)
penumbra_like_LEL 114..231 CDD:239411 44/164 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.