DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tspan10

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_003751041.2 Gene:Tspan10 / 688308 RGDID:1590062 Length:326 Species:Rattus norvegicus


Alignment Length:261 Identity:87/261 - (33%)
Similarity:128/261 - (49%) Gaps:43/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SCCLKYLLFASNVILWLSALLVLSVGIW----------AWSEKGMFRNIARLHFIALDPAFVLII 70
            |.|:|||:|.||.:..|.|||.|:.|:|          .|.|.           :..||..||::
  Rat    72 SSCVKYLIFLSNFLFSLPALLALAAGLWGLAVKRSQGSGWGEP-----------LPTDPMLVLML 125

  Fly    71 LGGVTFLLGFMGSVGALRENTCLLGAY--AIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLK 133
            .|.|..::...|.:||..||:|||..|  |:...:.|.|..|  |:...|.|.  ::|.....|.
  Rat   126 GGLVVSVVSLSGCLGAFCENSCLLHCYYGAVLSCLALEALAG--ALVVTLWDP--LQDSLKRTLH 186

  Fly   134 AFIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRP 198
            ..|.||..|.|...|:|.:|.. |||||.:..:||..|.||||||..:   :||.:|.|||....
  Rat   187 LAIIHYWNDPDLHFLLDQVQLG-LQCCGAESYQDWQQNLYFNCSSPGV---QACSLPASCCINLQ 247

  Fly   199 QE-VIKNKQCGYDVRKEGYPVDRN-----IHERGCLRAGEDWLEAHLISVAIGC-VALLVLQGME 256
            :: .:.|.|||..    ...:|.|     ::.:||....::||..::.::. || ||::::||.|
  Rat   248 EDGAVVNTQCGLG----ALHLDPNAAGQVVYLQGCWPVLQEWLRGNVGAIG-GCAVAVIMIQGTE 307

  Fly   257 L 257
            |
  Rat   308 L 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 82/253 (32%)
DUF2207 <65..157 CDD:303056 30/93 (32%)
TM4SF9_like_LEL 118..239 CDD:239412 42/126 (33%)
Tspan10XP_003751041.2 Tetraspannin 74..304 CDD:278750 82/253 (32%)
oculospanin_like_LEL 171..289 CDD:239420 42/127 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.