DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tspan15

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001108504.1 Gene:Tspan15 / 679462 RGDID:1588304 Length:294 Species:Rattus norvegicus


Alignment Length:298 Identity:88/298 - (29%)
Similarity:146/298 - (48%) Gaps:61/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RRETSEISCC-------LKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAF 66
            |.::.::..|       ||:.|...:.:.||...|||||||:|.:|:..::.:... |:|  ||.
  Rat     3 RGDSEQVRYCARFSYLSLKFSLIIYSTVFWLIGGLVLSVGIYAEAERQKYKTLESA-FLA--PAI 64

  Fly    67 VLIILGGVTFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEI--GFCAVAFVLKDKGWIKDQAT 129
            :||:||.|.|::.|:|.:.:||:|.|||.::...|.:.|:.|:  |..|:.|..:...::.|...
  Rat    65 ILILLGVVMFIVSFIGVLASLRDNLCLLQSFMFILGLCLVMELIGGIVALIFRNQTIDFLNDNIR 129

  Fly   130 EGLKAFIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCC 194
            .|    |.:|.:|.|.:|::|::|:.: :|||.:..:||..|.|.:||  |.|.. |||||::||
  Rat   130 RG----IENYYDDLDFKNIMDFVQKKF-KCCGGEDYRDWSKNQYHDCS--APGPL-ACGVPYTCC 186

  Fly   195 RRRPQEVIKNKQCGY-DVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMELS 258
            .|...:|: |..||| .:.||.......||.|||..                  |:|:       
  Rat   187 IRNTTDVV-NTMCGYKTIDKERLNAQNIIHVRGCTN------------------AVLI------- 225

  Fly   259 KIIYEKGCVQAGEEWMEHNLIIISATVIVVMFFQILGI 296
                          |...|..|::..::.::..|.||:
  Rat   226 --------------WFMDNYSIMAGLLLGILLPQFLGV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 81/244 (33%)
DUF2207 <65..157 CDD:303056 30/93 (32%)
TM4SF9_like_LEL 118..239 CDD:239412 40/121 (33%)
Tspan15NP_001108504.1 penumbra_like_LEL 114..231 CDD:239411 44/164 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.