DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tsp42Ea

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster


Alignment Length:312 Identity:67/312 - (21%)
Similarity:117/312 - (37%) Gaps:99/312 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ISC---CLKYLLFASNVILWLSALLVLSVGIWAWSE-KGM--FRNIARLHFIALDPAFVLIILGG 73
            :||   .:||:||..|::..:..:|::..|...:|: :.|  |....|...:.:    .:||||.
  Fly     1 MSCGISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPV----TMIILGT 61

  Fly    74 VTFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDK-----GWIKDQATEGLK 133
            :..|:.:.|..||:||:.|:...|:|.|.||:|.::......:|.|||     |.:.::|     
  Fly    62 IILLISWFGCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKA----- 121

  Fly   134 AFIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRP 198
                 :.....:.:.:|.||.. ::|||..|..|:.....|               |.|||.   
  Fly   122 -----WNHRTSRSDYMDAIQIS-MKCCGRSGYTDYAYQGKF---------------PPSCCS--- 162

  Fly   199 QEVIKNKQCGYDVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMELSKIIYE 263
                                |.|    .|     .|                        :.:|.
  Fly   163 --------------------DTN----NC-----RW------------------------ETVYR 174

  Fly   264 KGCVQAGEEWMEHNLIIISATVIVVMFFQILGICFAQNLRADI--YTQKSKW 313
            :||.....|:.:.|..||....:|:...:.:|..||..|...|  |.:::::
  Fly   175 RGCKVTFVEFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIRNYRRRAEY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 51/242 (21%)
DUF2207 <65..157 CDD:303056 26/96 (27%)
TM4SF9_like_LEL 118..239 CDD:239412 22/125 (18%)
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 63/294 (21%)
tetraspanin_LEL 104..188 CDD:239401 27/165 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.