DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and tspan33b

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_005159085.1 Gene:tspan33b / 567512 ZFINID:ZDB-GENE-060503-607 Length:266 Species:Danio rerio


Alignment Length:247 Identity:86/247 - (34%)
Similarity:150/247 - (60%) Gaps:12/247 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFVLIILGGVTFLLGFMGS 83
            ::|.||..:.:.|:.:||::::|::|.::|.  .:..|..|: :|||.:||::|.|.|.:.|.|.
Zfish    20 IRYFLFFFSFLFWVFSLLIVAIGVYAKAQKA--TDTVRDSFL-IDPAVILIVVGVVMFFITFCGC 81

  Fly    84 VGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYREDADQQNL 148
            :||||||..||..::..|:::.:.::....:.|...::  .:|...|.:|..|.|||:|.|.|||
Zfish    82 IGALRENIRLLKIFSFSLTLVFLTQMAIAILGFFYSEQ--TRDALGEFVKKAIVHYRDDLDLQNL 144

  Fly   149 IDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRPQEVIKNKQCGYDVRK 213
            :|:||::: :|||.....||..|.|||||| :..|.|.|.||||||...|:|.:.|..||:.::.
Zfish   145 MDYIQKEF-KCCGWTNYTDWSWNPYFNCSS-SNPSNERCSVPFSCCTPLPRETVINSMCGFGIQT 207

  Fly   214 EGY-PVDRNIHERGCLRAGEDWLEAHLI---SVAIGCVALLVLQGMELSKII 261
            :.: ...::|:..||......|:|:||:   ::.:| :||..:.|:.||:|:
Zfish   208 QNHLNATKSIYSVGCADRAVIWIESHLLLFGALTLG-LALPQIAGIVLSQIL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 82/237 (35%)
DUF2207 <65..157 CDD:303056 33/91 (36%)
TM4SF9_like_LEL 118..239 CDD:239412 46/121 (38%)
tspan33bXP_005159085.1 Tetraspannin 36..262 CDD:278750 82/231 (35%)
penumbra_like_LEL 114..234 CDD:239411 47/123 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X349
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.