DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and zgc:110329

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001017802.1 Gene:zgc:110329 / 550500 ZFINID:ZDB-GENE-050417-334 Length:346 Species:Danio rerio


Alignment Length:292 Identity:96/292 - (32%)
Similarity:148/292 - (50%) Gaps:38/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RETSEISCCLKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFVLIILGGV 74
            |:|......||:.|...:::..|..|.||.:|::|..|:...|.   |..:.|.||.|||:||.|
Zfish     8 RKTIHFYYFLKFSLNVYSMLFSLLGLYVLCIGVYAEVERQKNRT---LEGVFLAPAVVLILLGLV 69

  Fly    75 TFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLK---DKGWIK---DQATEGLK 133
            .|.:..:|.||:||:|..||..:...|.|||..:    |:|.::.   :|..||   :...||:|
Zfish    70 MFTVSVIGMVGSLRDNKTLLHMFLCVLCVLLALQ----AIALIIALIFEKTTIKLFQNSIREGIK 130

  Fly   134 AFIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRP 198
                ||.:|.|.:|::|::||.: .|||.|..|||:.|.|..|..   .|..|||||::||.|:.
Zfish   131 ----HYYDDLDFKNILDYVQEKF-SCCGGDEYKDWEVNQYHLCDG---KSPLACGVPYTCCIRQS 187

  Fly   199 QEVIKNKQCGY-DVRKEGYPVDRNIHERGCLRAGEDWLEAHL-ISVAIGC-VALLVLQGMELSKI 260
            ...:.|..||| .:.::...:|..||.|||:.|...|:..:: .::.|.| |.|..|.|:.||.:
Zfish   188 VGEVVNTLCGYKTLHQQREALDGVIHVRGCIHAVNLWMGDNIGATIGICCAVGLPQLLGILLSCV 252

  Fly   261 IYE--------------KGCVQAGEEWMEHNL 278
            .:.              |...:||.::.|.:|
Zfish   253 FWNLLVEMSESQDMVDFKFLKRAGYKYSELDL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 85/243 (35%)
DUF2207 <65..157 CDD:303056 36/97 (37%)
TM4SF9_like_LEL 118..239 CDD:239412 45/127 (35%)
zgc:110329NP_001017802.1 Tetraspannin 17..255 CDD:278750 89/252 (35%)
penumbra_like_LEL 111..229 CDD:239411 45/125 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.