DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tspan14

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001303677.1 Gene:Tspan14 / 52588 MGIID:1196325 Length:270 Species:Mus musculus


Alignment Length:310 Identity:120/310 - (38%)
Similarity:172/310 - (55%) Gaps:47/310 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FRRETSEISCCLKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRN---IARLHFIALDPAFVLI 69
            :|...:|:||..|||||:.|::.||:.::.|.||:|||||||:..:   :.|||  .:||..:::
Mouse     4 YRYSNAEVSCWYKYLLFSYNIVFWLAGVVFLGVGLWAWSEKGVLSDLTKVTRLH--GIDPVVLVL 66

  Fly    70 ILGGVTFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKA 134
            ::|.|.|.|||.|.|||||||.|||..:...:.::...|:....:||:.:|  |::|:..|..::
Mouse    67 MVGVVMFTLGFAGCVGALRENICLLKFFCGAIVLIFFLELAVAVLAFLFQD--WVRDRFREFFES 129

  Fly   135 FIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRPQ 199
            .|:.||:|.|.|||||.:|:. .||||..||:|||.|.|||||. |..|||.||||||||...|.
Mouse   130 NIKSYRDDIDLQNLIDSLQKA-NQCCGAYGPEDWDLNVYFNCSG-ASYSREKCGVPFSCCVPDPA 192

  Fly   200 EVIKNKQCGYDVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMELSKIIYEK 264
            :.:.|.|||||||               ::....|                       .:.|:.|
Mouse   193 QKVVNTQCGYDVR---------------IQLKSKW-----------------------DEFIFTK 219

  Fly   265 GCVQAGEEWMEHNLIIISATVIVVMFFQILGICFAQNLRADIYTQKSKWH 314
            ||:||.|.|:..|:.|::...|.:...||.||..|:.|.:||...|:..|
Mouse   220 GCIQALEGWLPRNIYIVAGVFIAISLLQIFGIFLARTLISDIEAVKAGHH 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 95/237 (40%)
DUF2207 <65..157 CDD:303056 35/91 (38%)
TM4SF9_like_LEL 118..239 CDD:239412 52/120 (43%)
Tspan14NP_001303677.1 TM4SF9_like_LEL 113..233 CDD:239412 61/161 (38%)
Necessary and sufficient for interaction with ADAM10. /evidence=ECO:0000250|UniProtKB:Q8NG11 114..232 60/159 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 213 1.000 Domainoid score I2738
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3390
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48585
OrthoDB 1 1.010 - - D1180379at2759
OrthoFinder 1 1.000 - - FOG0001766
OrthoInspector 1 1.000 - - otm43961
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X349
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.