DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and tspan14

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001007871.1 Gene:tspan14 / 493257 XenbaseID:XB-GENE-868280 Length:270 Species:Xenopus tropicalis


Alignment Length:307 Identity:119/307 - (38%)
Similarity:170/307 - (55%) Gaps:47/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FRRETSEISCCLKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNI---ARLHFIALDPAFVLI 69
            :|..|:|:|||.|||||:.|:|.|||.:::|.||:|||||||:..:|   .|||  ..||.::::
 Frog     4 YRYSTAEVSCCYKYLLFSYNIIFWLSGMVLLGVGLWAWSEKGILSDITKVTRLH--GFDPVWLVL 66

  Fly    70 ILGGVTFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKA 134
            ::|.:.|.|||.|.|||||||.|||..:...:.::...|:....:||:.:|  |:||:|.:..:.
 Frog    67 VVGVIMFTLGFAGCVGALRENICLLKFFCGAIVLIFFMELAVAVLAFLFQD--WVKDRAKDFFEN 129

  Fly   135 FIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRPQ 199
            .|:.||:|.|.|||||.:|:. .||||...|.|||.|.|||| |:...|||.||||||||...|.
 Frog   130 NIKSYRDDIDLQNLIDSLQKA-NQCCGAVSPDDWDLNEYFNC-SVENPSRERCGVPFSCCVPDPA 192

  Fly   200 EVIKNKQCGYDVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMELSKIIYEK 264
            :.:.|.|||||.|::                                      :..|.....:.|
 Frog   193 QTVVNTQCGYDARRK--------------------------------------KPNERPNTTFSK 219

  Fly   265 GCVQAGEEWMEHNLIIISATVIVVMFFQILGICFAQNLRADIYTQKS 311
            ||:.|.|.|:..|:.|::...:|:...||.||..|:.|.:||...|:
 Frog   220 GCISALEAWLPRNIYIVAGVFLVISILQIFGIYLARTLMSDIEAVKA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 95/237 (40%)
DUF2207 <65..157 CDD:303056 35/91 (38%)
TM4SF9_like_LEL 118..239 CDD:239412 49/120 (41%)
tspan14NP_001007871.1 TM4SF9_like_LEL 113..233 CDD:239412 57/161 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2744
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3308
OMA 1 1.010 - - QHG48585
OrthoDB 1 1.010 - - D1180379at2759
OrthoFinder 1 1.000 - - FOG0001766
OrthoInspector 1 1.000 - - otm49136
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X349
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.