DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tsp97E

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster


Alignment Length:203 Identity:38/203 - (18%)
Similarity:75/203 - (36%) Gaps:49/203 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CLKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFV--LIILGGVTFLLGF 80
            |.|..|.|.|::..:...|::.||::           ||...|..:...|  ::..|.:...:..
  Fly     7 CSKNALIALNILYVMIGFLLIGVGVY-----------ARAASIVTNLPIVGGILACGVILICISM 60

  Fly    81 MGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLK--------DKGWIKDQATEGLKAFIR 137
            :|..||::.:..:|..|.|.|.:|.:.:....:....:.        ::||:.            
  Fly    61 LGLAGAVKHHQVMLFFYMIILFMLFLIQFSIASSCLAVNSEQQQQFAEQGWMT------------ 113

  Fly   138 HYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSRE-ACG-VPFSCCRRRPQE 200
             ...|..:|      .:|.|:|||.:....       :.:|:...|.| :|. :...||....:.
  Fly   114 -VPTDLRKQ------VQDSLKCCGFNATAP-------STTSVVPPSNEPSCELINQQCCAHSSEP 164

  Fly   201 VIKNKQCG 208
            ..:.:.||
  Fly   165 DCRCEPCG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 38/203 (19%)
DUF2207 <65..157 CDD:303056 15/101 (15%)
TM4SF9_like_LEL 118..239 CDD:239412 17/101 (17%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 38/203 (19%)
tetraspanin_LEL <121..177 CDD:243179 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442868
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.