DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tsp74F

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:263 Identity:63/263 - (23%)
Similarity:126/263 - (47%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TSEISCC---LKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFVLIILGG 73
            :|.:.||   :||.||.:|.::::...:|..:.:|...::.....:...:..: ...:||::...
  Fly     4 SSRMDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFS-GAVYVLLVTSI 67

  Fly    74 VTFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRH 138
            :..|:.|:|.|||.:|..|||..|.|.::::.:..:....:.:|.:::  ::....:.:::.:..
  Fly    68 IICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRER--VQQTMRQEMRSTMAL 130

  Fly   139 Y--REDADQQNLIDW-IQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRPQE 200
            |  |.:..|.    | :.::.|||||:|...||  |.|        |.     ||.|||    ||
  Fly   131 YGSRREITQA----WDLTQERLQCCGVDTWHDW--NRY--------GP-----VPESCC----QE 172

  Fly   201 VI--KNKQCGYDVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIG----CVALLVLQGMELSK 259
            :.  :.|:|..      :|...|::.:|||....:::..|  :..||    .||:|::.||..|.
  Fly   173 LFGGQRKECTI------FPTITNLYNQGCLYVTTNFIRDH--AAVIGGTSIAVAILMIFGMIFSC 229

  Fly   260 IIY 262
            :::
  Fly   230 LLF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 58/246 (24%)
DUF2207 <65..157 CDD:303056 19/94 (20%)
TM4SF9_like_LEL 118..239 CDD:239412 29/125 (23%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 60/250 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.