DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tsp42Eq

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster


Alignment Length:265 Identity:59/265 - (22%)
Similarity:100/265 - (37%) Gaps:67/265 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ISCCLKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALD-PAFVLIILGGVTFLL 78
            :||..|.|..:|.|:.:|..:|. ::.|.|.|    :..||..|.:|:. |:.:.|:|||:.|..
  Fly     1 MSCGTKALKVSSFVLDFLCCVLA-ALTIAACS----YALIAFSHSVAIRVPSILGIVLGGLLFFS 60

  Fly    79 GFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFC---AVAFVLKDKGWIKDQATEGLKAFIRHYR 140
            ...|.:.||||:..:...||..|..|:.::|...   .:.:.|.....|.| |.:|     :.|.
  Fly    61 TIFGCIAALRESIRMTWIYAAILLALVFSQITVILAQPINYELLANETIYD-AWQG-----QLYH 119

  Fly   141 EDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRPQEVIKNK 205
            .|......|.:      .|||..||.::..:...              :|.||            
  Fly   120 SDRMSYFEIKY------HCCGQTGPANYPDSGLV--------------IPQSC------------ 152

  Fly   206 QCGYDVRKEGYPVDRNIHERGC---LRAG----------EDW--LEAHLISVAIGCVALLVLQGM 255
                 ...:...|..:::..||   |.|.          .||  :...:::|.|..:..:.||..
  Fly   153 -----YFNQNATVTTDLYTVGCNHQLAAAFVKGTRWEKITDWSVVGVEILTVIIAGLLAITLQNA 212

  Fly   256 ELSKI 260
            |..::
  Fly   213 ERRRL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 54/253 (21%)
DUF2207 <65..157 CDD:303056 23/94 (24%)
TM4SF9_like_LEL 118..239 CDD:239412 23/135 (17%)
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 53/248 (21%)
tetraspanin_LEL 95..173 CDD:239401 19/120 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.