DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tsp42Ep

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001260759.1 Gene:Tsp42Ep / 35626 FlyBaseID:FBgn0033137 Length:250 Species:Drosophila melanogaster


Alignment Length:255 Identity:51/255 - (20%)
Similarity:92/255 - (36%) Gaps:79/255 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LSALLVLSVGIWAWSEKGMFRNIA------RLHFIALDPAFVLIILGGVTFLLGFMGSVGALREN 90
            ||.||.:.:||...|..|:...:|      ..:|:.      .::|||...::...|..|.:...
  Fly    14 LSNLLYMLLGIGVMSGAGLGLQMAEPNTPEHTYFVK------SLVLGGSICMIVMFGCYGMVANL 72

  Fly    91 TCLLGAYAIFLSVLLIAEIGFCAVAFV---------LKDKG--WIK-DQATEGLKAFIRHYREDA 143
            .|:...:.:|:.:.|.||       ::         |:..|  |.: :.|..||         |.
  Fly    73 LCVNLIFTMFILIALAAE-------YLQLHHYHSPSLRSPGGAWQQLELAWHGL---------DR 121

  Fly   144 DQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRPQEVIKNKQCG 208
            |.:.:..:  |....|||.:|..|:              .|....||.||.    |..:.     
  Fly   122 DPELMHQY--EASQHCCGYNGADDY--------------KRLHLLVPASCY----QAAVN----- 161

  Fly   209 YDVRKEGYPVDRNIHERGCLRA---GEDWLEAH---LISVAIGCVALLVLQGMELSKIIY 262
             |..::.||       .|||..   .:.:::..   .:...:|....::||.:.||.:::
  Fly   162 -DTAQQIYP-------SGCLETLNRSQRYIQHRDKLYMWAIVGLEIFILLQTVALSVLLF 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 47/244 (19%)
DUF2207 <65..157 CDD:303056 19/103 (18%)
TM4SF9_like_LEL 118..239 CDD:239412 26/129 (20%)
Tsp42EpNP_001260759.1 Tetraspannin <51..213 CDD:278750 41/210 (20%)
tetraspanin_LEL 91..183 CDD:239401 26/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.