DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tsp42Eo

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster


Alignment Length:260 Identity:50/260 - (19%)
Similarity:83/260 - (31%) Gaps:96/260 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ISCCLKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFVLIILGGVTFLLG 79
            :..||::.....:.:..:..:|....|::   |...|...:..|    ...||.:.:.|...|.|
  Fly     4 VRVCLQWTSVVFSTLTLIVGVLAALAGVY---ELDKFNEGSAEH----TEKFVQLGMAGALILAG 61

  Fly    80 FMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYRE--- 141
            .:|.:||:..:..::....|.|..|:.:.|             |           .:.||.|   
  Fly    62 LVGCLGAIFGSIKVMVVNLILLLALIASHI-------------W-----------KVSHYNETKQ 102

  Fly   142 -DADQQNLID-WIQE-----------DWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSC 193
             ||.:..::| |::|           ...:|||..|..|:.|.|              ..||.||
  Fly   103 LDATEVYVMDLWMKELVHHGAMQDLQQEYECCGDKGFSDYTSLN--------------MKVPRSC 153

  Fly   194 CRRRPQEVIKNKQCGYDVRKEG----YPVDRNIHERGCLRA----------GEDWLEAHLISVAI 244
            ..                .|:|    ||     :..||:.|          .|.|:...||...:
  Fly   154 FH----------------TKDGIHALYP-----YGEGCMAAVKRAYLQIYRYEKWVHCGLIGYEV 197

  Fly   245  244
              Fly   198  197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 50/257 (19%)
DUF2207 <65..157 CDD:303056 21/107 (20%)
TM4SF9_like_LEL 118..239 CDD:239412 29/150 (19%)
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 50/257 (19%)
tetraspanin_LEL 110..178 CDD:239401 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.