DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tsp42Ej

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster


Alignment Length:241 Identity:47/241 - (19%)
Similarity:88/241 - (36%) Gaps:53/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFVLIILGGVTFLLGFMGSV 84
            ||.|..:.:::....:...|.|:..|...           :::..::...:.||..|.:.|:|..
  Fly    11 KYGLLVTCILIVTCNVFFFSCGVTTWGSA-----------VSVYGSYGSALCGGAVFGVAFLGMY 64

  Fly    85 GALRENTCLLGAYAIFLSVLLIAEIGFCAVAF-VLKDK--GWIKDQATEGLKAFIRHYREDADQQ 146
            .||:. :.....|.:..|.|:||.:|.....| .::::  |..:::..:   .|.|....|...|
  Fly    65 VALKV-SYKYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRD---LFERKTHSDDKMQ 125

  Fly   147 NLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRPQEVIKNKQCGYDV 211
            .:     .....||||:||:|:             ...|...:|.|||            ..:|.
  Fly   126 PV-----HSLFGCCGIEGPQDY-------------LQEEHGALPSSCC------------YAFDC 160

  Fly   212 RKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMEL 257
            .|..:     ::|.||.......|..........|:|::.|:.:.|
  Fly   161 SKPAH-----VYEEGCSTKAVATLRMQAELNYYSCMAIIALEFLGL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 45/235 (19%)
DUF2207 <65..157 CDD:303056 19/94 (20%)
TM4SF9_like_LEL 118..239 CDD:239412 23/122 (19%)
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 47/241 (20%)
tetraspanin_LEL 97..183 CDD:239401 23/123 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.