DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tsp42Ei

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001260756.1 Gene:Tsp42Ei / 35618 FlyBaseID:FBgn0033130 Length:229 Species:Drosophila melanogaster


Alignment Length:244 Identity:53/244 - (21%)
Similarity:96/244 - (39%) Gaps:61/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LKYLLFASNVILWLSALLVLSVGIW-----AWSEKGMFRNIARLHFIALDPAFVLIILGGVTFLL 78
            :|::|...|.:..:..|.:::.||:     |.:...:.:|:|         ..::|.||.|..::
  Fly     8 VKHVLLLLNFVFSVLGLALIAFGIFFLISAAENAVSIGKNVA---------GGLIIALGVVILII 63

  Fly    79 GFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYREDA 143
            ...|.:.|:.|....|..|...:.:|::|::.|..:: ....|..|.....||   |.|.:..:.
  Fly    64 AIFGCLAAIHEAPVRLLIYVGAVVLLILAQLIFLGMS-SHGTKDGISGSINEG---FDRLWESER 124

  Fly   144 DQQNLIDWIQEDWLQCCGIDGPKD-WDSNNYFNCSSIAIGSREACGVPFSCCRR-----RPQEVI 202
            :|...:.: .|.||||||::..:| |..::               |:|.|||..     .|..|.
  Fly   125 NQTGALSY-YESWLQCCGVNSSEDYWIIHH---------------GIPSSCCPESKCMDTPSRVF 173

  Fly   203 KNKQCGYDVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLV 251
            |.                     ||..|...:|:..|:...|.|..|::
  Fly   174 KT---------------------GCKAAFVKYLDDKLLVFKIVCWLLVI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 53/244 (22%)
DUF2207 <65..157 CDD:303056 20/91 (22%)
TM4SF9_like_LEL 118..239 CDD:239412 28/126 (22%)
Tsp42EiNP_001260756.1 Tetraspannin 7..217 CDD:278750 53/244 (22%)
DUF373 <17..>101 CDD:299895 18/93 (19%)
tetraspanin_LEL 104..189 CDD:239401 28/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442905
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.