DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tsp42Eh

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster


Alignment Length:182 Identity:45/182 - (24%)
Similarity:76/182 - (41%) Gaps:25/182 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LKYLLFASNVILWLSALLVLSVGIW---AWSEKGMFRNIARLHFIALDPAFVLIILGGVTFLLGF 80
            |:|:|...:.|..|...|::..|.|   :.||:.....:.....:|   |.:.::||.|..:...
  Fly     8 LRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLA---AVLCVLLGTVIVVASI 69

  Fly    81 MGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYREDADQ 145
            .|||...:::..||..||:.|..|||.:|...::::. ..:.::.|...:||........|....
  Fly    70 FGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYA-ASRDFLPDSLRQGLDDLWDLQHEGNST 133

  Fly   146 QNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRR 197
            .|    ..|:||.|||.:..:|     |.:...:.         |.|||..|
  Fly   134 LN----TYEEWLHCCGRNSAED-----YLHLEKMP---------PPSCCLNR 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 45/182 (25%)
DUF2207 <65..157 CDD:303056 22/91 (24%)
TM4SF9_like_LEL 118..239 CDD:239412 18/80 (23%)
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 45/182 (25%)
tetraspanin_LEL 109..192 CDD:239401 18/77 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442904
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.