DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tsp42Eg

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster


Alignment Length:248 Identity:58/248 - (23%)
Similarity:93/248 - (37%) Gaps:87/248 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIAL-----DPAFVLIILGGVTFLLGFMGSVGA 86
            ::||.|..|:|:.:|:               |.|..     ..|||:|.:|.|..|....|::||
  Fly    16 DIILALFGLVVIGLGV---------------HIIYKFEHFNTAAFVIIAVGVVVVLTALFGALGA 65

  Fly    87 LRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGL----KAFIRHYRED----- 142
            .||::.....:.:.|.||:|.|:  .||.|:     |:..  |..|    |.|.:.:.:.     
  Fly    66 ARESSATSKVFVVILIVLVILEV--LAVGFL-----WVFQ--TSLLINVDKTFDKLWNDQPVPIK 121

  Fly   143 -ADQQNLIDWIQEDWLQCCGIDGPKDW--DSNNYFNCSSIAIGSREACGVPFSCCRRRPQEVIKN 204
             .:|..:..  .|.||.|||..||.|:  ..|:.:|..|..:.        ...||::..:.|.:
  Fly   122 PGNQSQIAS--LERWLDCCGNVGPSDYILPPNSCYNGESDKLN--------LEGCRQKFLDFIAD 176

  Fly   205 KQCGYDVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMEL 257
            :                            |...:|:|        |||.|:||
  Fly   177 R----------------------------WTTFNLVS--------LVLLGVEL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 54/242 (22%)
DUF2207 <65..157 CDD:303056 27/101 (27%)
TM4SF9_like_LEL 118..239 CDD:239412 22/132 (17%)
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 58/247 (23%)
tetraspanin_LEL 95..176 CDD:239401 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442923
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.