DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and Tsp5D

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:335 Identity:78/335 - (23%)
Similarity:131/335 - (39%) Gaps:100/335 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CLKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHF-IALDPAFVLIILGGVTFLLGFM 81
            |::......|:||||.:...|..|:|.......:..:...|. ::.|..|:.|  ||..|::.|.
  Fly     8 CIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGI--GGTGFVVSFF 70

  Fly    82 GSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYREDADQQ 146
            |..||..::.|||..|.:.:.:|.::|....::||:.:. |..:..|.|......||| ..:|:.
  Fly    71 GCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRG-GLGRTLANELRFGIERHY-NSSDRG 133

  Fly   147 NLI--------DWIQEDWLQCCGIDGPKDW-DSNNYFNCSSIAIGSREACGVPFSCCRRRPQEVI 202
            :|:        |.:|:.: :|||:...:|| |..::       .|.|   .||.||||..     
  Fly   134 SLVAPSVASIWDSVQQSF-ECCGVSSYEDWYDIQSW-------PGRR---WVPESCCRTL----- 182

  Fly   203 KNKQCGYDVRK---EGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGM--------E 256
                  ||.|:   ||              :|:                     ||        |
  Fly   183 ------YDQRQVLTEG--------------SGD---------------------GMMRPDCGRSE 206

  Fly   257 LSKIIYEKGCVQAGEEWMEHNLIIISATVIVVMFFQILGI-------CFAQNLRA-DIY------ 307
            ...:.::|||..:.:.|....|.::.|..:.:.|.|:.|:       |..::.|| |.|      
  Fly   207 NPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKRASDTYKSYSPS 271

  Fly   308 ----TQKSKW 313
                |:.|.|
  Fly   272 IDPQTRTSSW 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 58/247 (23%)
DUF2207 <65..157 CDD:303056 27/99 (27%)
TM4SF9_like_LEL 118..239 CDD:239412 30/132 (23%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 71/308 (23%)
NET-5_like_LEL 105..228 CDD:239418 38/181 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.