DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and tsp-1

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_498804.1 Gene:tsp-1 / 192096 WormBaseID:WBGene00006627 Length:244 Species:Caenorhabditis elegans


Alignment Length:177 Identity:42/177 - (23%)
Similarity:78/177 - (44%) Gaps:37/177 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDP-----------AFVLII-- 70
            ::.:||..::.:.|:||.:::||.|...:.....::..:.:...||           .:::::  
 Worm     8 IRSVLFFLDLAMLLAALALIAVGFWMGYDSSFDTDLKNVIYKYDDPKSLADAKFNIRVWLIVVFW 72

  Fly    71 ------LGG-VTFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQA 128
                  ||. ||.:||.:.||...|:...:  .|.:.:.||:..||| |.|| ||..:..:.|..
 Worm    73 SIIGLSLGAVVTAVLGMISSVWPKRKGFMI--TYLVLIIVLVSLEIG-CGVA-VLVRRNSLHDNT 133

  Fly   129 TEGLKAFIRHYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFN 175
            ...:.|..     ..:..|.:..||:.: .||||:       |:.||
 Worm   134 NSLIDAMY-----TTNSVNDLKIIQDKY-NCCGIE-------NSLFN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 42/177 (24%)
DUF2207 <65..157 CDD:303056 25/100 (25%)
TM4SF9_like_LEL 118..239 CDD:239412 13/58 (22%)
tsp-1NP_498804.1 Tetraspannin 29..>163 CDD:278750 34/150 (23%)
DUF805 66..>131 CDD:294752 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.