DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and LOC101730599

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_017947977.1 Gene:LOC101730599 / 101730599 -ID:- Length:311 Species:Xenopus tropicalis


Alignment Length:257 Identity:91/257 - (35%)
Similarity:137/257 - (53%) Gaps:29/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFVLIILGGVTFLLGFMGSV 84
            |:.|...:.:..|..|::|.:||:|.||:...|.   |..|.|.||.:|::||.:.|.:.|:|.|
 Frog    18 KFSLSFYSTLFSLIGLVILCIGIYAESERQKHRT---LEGIFLAPAVILLLLGIIMFAVSFIGMV 79

  Fly    85 GALRENTCLLGAY-----AIFL--SVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYRED 142
            |:||:|..|:..:     ||||  .:|:|.|:.|         :..:|..|...:...::.|.:|
 Frog    80 GSLRDNILLVKLFFWVLLAIFLIELLLIIIELVF---------ENQMKKFAHANILVGMQQYYDD 135

  Fly   143 ADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCC-RRRPQEVIKNKQ 206
            .|.:|::|::||.: .|||.|..|||..|.|.:|:|.   ...|||||::|| ..:....:||..
 Frog   136 LDFKNIMDFVQEKF-SCCGGDDFKDWKVNQYHSCNST---GPLACGVPYTCCITGKESGGVKNTL 196

  Fly   207 CGYD-VRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCV-ALLVLQGM--ELSKIIYEK 264
            |||. :.||...|...||.|||:.|...||..: ..|.||.| |||..||:  .||.:.::|
 Frog   197 CGYQTLDKERLEVHSIIHVRGCIHAVGLWLGDN-YGVTIGLVLALLAPQGLGIGLSYLFWQK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 86/242 (36%)
DUF2207 <65..157 CDD:303056 30/98 (31%)
TM4SF9_like_LEL 118..239 CDD:239412 43/122 (35%)
LOC101730599XP_017947977.1 penumbra_like_LEL 112..230 CDD:239411 44/131 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.