DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and LOC100492058

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_002934422.3 Gene:LOC100492058 / 100492058 -ID:- Length:300 Species:Xenopus tropicalis


Alignment Length:283 Identity:84/283 - (29%)
Similarity:143/283 - (50%) Gaps:38/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TSEISCCLKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFVLIILGGVTF 76
            |::|   :||.||.|..:.|:::.|:::|||:|    ...:....:..:..|||.::..:|.:.|
 Frog     3 TNQI---VKYSLFVSCYLFWVASGLMIAVGIYA----KFCKETTIVDSLTTDPAVIVTAVGILMF 60

  Fly    77 LLGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYRE 141
            .:.|:|.:||||:...||..:|..|.::||.:.....:.|:.  .|.:.::.:..:...|..|||
 Frog    61 AITFVGCMGALRDLHILLKIFAWMLLIVLILQFVAAVLGFMF--SGMVLEKVSSVMTRAINRYRE 123

  Fly   142 DADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRPQEVIKNKQ 206
            |.|.||.||::|:.: :|||::..:||..|.||.||. :..|.|.||||:|||.:...:.:.|..
 Frog   124 DLDLQNFIDYLQKKF-ECCGVNNYRDWSQNLYFYCSE-SNPSLEKCGVPYSCCIKENGQKVINTM 186

  Fly   207 CGYDVR-KEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMELSKIIYEKGCVQAG 270
            |||..: :..:.||..|:..|||.....|          |...||:|.|:.:..|..|       
 Frog   187 CGYQTQNRMQWDVDDMIYVEGCLDKIVSW----------GRGNLLLLGGLAMGLIFLE------- 234

  Fly   271 EEWMEHNLIIISATVIVVMFFQI 293
                     |..|::.:::.:||
 Frog   235 ---------IFVASLAIILIYQI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 74/235 (31%)
DUF2207 <65..157 CDD:303056 28/91 (31%)
TM4SF9_like_LEL 118..239 CDD:239412 42/121 (35%)
LOC100492058XP_002934422.3 Tetraspannin 7..244 CDD:366035 80/270 (30%)
penumbra_like_LEL 100..215 CDD:239411 42/118 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.