DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp26A and tspan15

DIOPT Version :9

Sequence 1:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001017773.1 Gene:tspan15 / 100000710 ZFINID:ZDB-GENE-050417-295 Length:296 Species:Danio rerio


Alignment Length:300 Identity:84/300 - (28%)
Similarity:140/300 - (46%) Gaps:67/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TSEISCC-------LKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFIALDPAFVLI 69
            |.|:..|       ||:.|.....|.||....:|::||:|..|:..::.   |..:.|.||.:||
Zfish     2 TGEVRYCEKCSYFFLKFSLIGYATIFWLIGGFILAIGIYAEVERQRYKT---LEGVFLAPAIILI 63

  Fly    70 ILGGVTFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEI--GFCAVAFVLKDKGWIKDQATEGL 132
            :||.:.|::.|:|.:.:||:|.|||..:...|::.|:.|:  |..|:.|        |:|..:.|
Zfish    64 VLGIIMFIVSFIGVLASLRDNLCLLKVFLYMLALCLVLELVGGIVALIF--------KNQTVDIL 120

  Fly   133 KAFIR----HYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSC 193
            ...||    :|.:|.|.:|::|::|:.: :|||....:||:.|.|.|||  |.|.. ||..|::|
Zfish   121 NKNIRKGMVNYYDDLDFKNIMDFVQKTF-KCCGGTEYQDWEVNMYHNCS--APGPL-ACAAPYTC 181

  Fly   194 CRRRPQEVIKNKQCGYDVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMELS 258
            |...|.||: |..|||..      ::::.||.                                :
Zfish   182 CIVTPGEVV-NTMCGYKT------LNKDRHEN--------------------------------T 207

  Fly   259 KIIYEKGCVQAGEEWMEHNLIIISATVIVVMFFQILGICF 298
            .:||.:||..|...|:..|...::..::.:...|..|:.|
Zfish   208 DVIYIRGCTDAVFIWLIDNYKTMAGLLLGIFLPQFFGVIF 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 72/247 (29%)
DUF2207 <65..157 CDD:303056 31/97 (32%)
TM4SF9_like_LEL 118..239 CDD:239412 37/124 (30%)
tspan15NP_001017773.1 Tetraspannin 16..252 CDD:278750 80/285 (28%)
MgtE <54..>113 CDD:280023 22/66 (33%)
penumbra_like_LEL 110..227 CDD:239411 44/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D574036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.