DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lid and KDM4D

DIOPT Version :9

Sequence 1:NP_001245908.1 Gene:lid / 33837 FlyBaseID:FBgn0031759 Length:1838 Species:Drosophila melanogaster
Sequence 2:NP_060509.2 Gene:KDM4D / 55693 HGNCID:25498 Length:523 Species:Homo sapiens


Alignment Length:428 Identity:117/428 - (27%)
Similarity:172/428 - (40%) Gaps:120/428 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 SNASCGLSGVTPTTKPSAGVFVKTETKEEFKRDLLSSFNAVNSGGSPLATGTTANTRGASQKKGG 436
            |.|:|       ...|:..:.:...|||||     :.|:                          
Human     6 SKANC-------AQNPNCNIMIFHPTKEEF-----NDFD-------------------------- 32

  Fly   437 EPPALIVDPLMKYICHICNRGDVEESMLLCDGCDDSYHTFCLLPPLTSIPKGEWLCPRCVVEEVS 501
                       |||.::.::|.....:                  ...||..||.. |...:.:|
Human    33 -----------KYIAYMESQGAHRAGL------------------AKIIPPKEWKA-RETYDNIS 67

  Fly   502 K-------PQEAFG-------FEQAEREYTLQQFGQMADQFKQEYFRKPVHLVPTEMVEREFW-- 550
            :       .|.|.|       :.:.::..|:.::..:|:..|   ::.|.| ...|.:||::|  
Human    68 EILIATPLQQVASGRAGVFTQYHKKKKAMTVGEYRHLANSKK---YQTPPH-QNFEDLERKYWKN 128

  Fly   551 RIVSSIDEDVTVEYGADLHTMDHGSGFPTKSSLYLLPGDQEYAESSWNLNNLPLLEDSILGHINA 615
            ||.:|      ..||||:    .||.|...:             ..|||.:|..::|.:......
Human   129 RIYNS------PIYGADI----SGSLFDENT-------------KQWNLGHLGTIQDLLEKECGV 170

  Fly   616 DISGMNAPWMYVGMCFAAFCWHNEDHWSYSINYLHWGEPKTWYGVPGSCAEQFEETMKQAAPELF 680
            .|.|:|.|::|.||....|.||.||...|||||||.|||||||.||....::.|...::..|...
Human   171 VIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHLGEPKTWYVVPPEHGQRLERLARELFPGSS 235

  Fly   681 SSQPDLLHQLVTIMNPNILMNNRVPVFRTDQHAGEFVITFPRAYHAGFNQGYNFAEAVNFAPADW 745
            ......|...|.:::|.:|..|.:|..|..|.||||::|||..||||||.|:|.|||:|||...|
Human   236 RGCGAFLRHKVALISPTVLKENGIPFNRITQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRW 300

  Fly   746 L---KMGRECVNHYSMLRRFCVFSHDELVCKMALEPAK 780
            :   ||..:|    |.......||.|..|  ..|:|.:
Human   301 IDYGKMASQC----SCGEARVTFSMDAFV--RILQPER 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lidNP_001245908.1 JmjN 160..201 CDD:128818
ARID 227..312 CDD:198082
PHD1_Lid_like 450..495 CDD:277078 6/44 (14%)
JmjC 624..740 CDD:202224 52/115 (45%)
zf-C5HC2 830..882 CDD:280996
PLU-1 896..1229 CDD:285609
PHD2_KDM5A 1295..1351 CDD:277079
PHD3_KDM5A_like 1755..1805 CDD:277083
KDM4DNP_060509.2 JmjN 19..53 CDD:280526 10/93 (11%)
JmjC 179..295 CDD:202224 52/115 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.