DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lid and ATP5F1B

DIOPT Version :9

Sequence 1:NP_001245908.1 Gene:lid / 33837 FlyBaseID:FBgn0031759 Length:1838 Species:Drosophila melanogaster
Sequence 2:NP_001677.2 Gene:ATP5F1B / 506 HGNCID:830 Length:529 Species:Homo sapiens


Alignment Length:393 Identity:71/393 - (18%)
Similarity:120/393 - (30%) Gaps:144/393 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   938 LNAAAV---EAEKCVTVIQQLGINKVRTRSDHNQEAAQYKLTMEELELFVQEIDNLCCIIDEGAS 999
            |||..|   |....:.|.|.||.:.|||            :.|:..|..|:...    ::|.||.
Human    83 LNALEVQGRETRLVLEVAQHLGESTVRT------------IAMDGTEGLVRGQK----VLDSGAP 131

  Fly  1000 V----------RELLVLG-----------KQFVERSESQLQLSLESLEESELETLIN-------- 1035
            :          |.:.|:|           |||........:....|:|:..|.|.|.        
Human   132 IKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPY 196

  Fly  1036 ---------EGSSLRIELQQLDLLQKRLKQCKWYKRSQGLRETSSKLTYQDVKNLLH-------I 1084
                     .|:.:...:..::|:....|....|....|:.|.:     ::..:|.|       |
Human   197 AKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERT-----REGNDLYHEMIESGVI 256

  Fly  1085 AAADLDPTDPYVDKEMRKLQQIGADIEAWESQAAKYFRRLTQQHEL---GEIEQFLKSASDIN-- 1144
            ...|.......|..:|.:.....|.:.......|:|||....|..|   ..|.:|.::.|:::  
Human   257 NLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSAL 321

  Fly  1145 -GQVPSHGLLKDALRKAREWLRAVEQLQQNNHVTYCHTLEAMIERGLNIPIQLEELSRMQGHLNS 1208
             |::||                         .|.|..||..             ::..||..:.:
Human   322 LGRIPS-------------------------AVGYQPTLAT-------------DMGTMQERITT 348

  Fly  1209 AHQWKDNTACAFLKKGTFYTLLEVLMPRSDAINIDSDLKPRFQDDFLKEKNPAEIVASFKHAEEQ 1273
            .            |||:..::..:.:|..|                |.:..||   .:|.|.:..
Human   349 T------------KKGSITSVQAIYVPADD----------------LTDPAPA---TTFAHLDAT 382

  Fly  1274 ELL 1276
            .:|
Human   383 TVL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lidNP_001245908.1 JmjN 160..201 CDD:128818
ARID 227..312 CDD:198082
PHD1_Lid_like 450..495 CDD:277078
JmjC 624..740 CDD:202224
zf-C5HC2 830..882 CDD:280996
PLU-1 896..1229 CDD:285609 63/344 (18%)
PHD2_KDM5A 1295..1351 CDD:277079
PHD3_KDM5A_like 1755..1805 CDD:277083
ATP5F1BNP_001677.2 PRK09280 58..524 CDD:236447 71/393 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.