DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lid and Kdm4b

DIOPT Version :9

Sequence 1:NP_001245908.1 Gene:lid / 33837 FlyBaseID:FBgn0031759 Length:1838 Species:Drosophila melanogaster
Sequence 2:NP_001037701.2 Gene:Kdm4b / 301128 RGDID:1588576 Length:1099 Species:Rattus norvegicus


Alignment Length:293 Identity:96/293 - (32%)
Similarity:139/293 - (47%) Gaps:43/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 IPKGEWLCPRCVVEEVSK-------PQEAFGFEQAEREYTLQQFGQMADQFKQ----EYFRKPVH 538
            ||..||. ||...:::..       .|...|......:|.:|:......::::    |.:..|.|
  Rat    49 IPPKEWK-PRQTYDDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRH 112

  Fly   539 LVPTEMVEREFWR---IVSSIDEDVTVEYGADLHTMDHGSGFPTKSSLYLLPGDQEYAESSWNLN 600
             ...:.:||::|:   .||.|       ||||:      ||     |||    |.:.|:  ||:.
  Rat   113 -QDFDDLERKYWKNLTFVSPI-------YGADI------SG-----SLY----DDDVAQ--WNIG 152

  Fly   601 NLPLLEDSILGHINADISGMNAPWMYVGMCFAAFCWHNEDHWSYSINYLHWGEPKTWYGVPGSCA 665
            ||..:.|.:.......|.|:|.|::|.||....|.||.||...|||||||:||||:||.:|....
  Rat   153 NLRSILDMVERECGTIIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHG 217

  Fly   666 EQFEETMKQAAPELFSSQPDLLHQLVTIMNPNILMNNRVPVFRTDQHAGEFVITFPRAYHAGFNQ 730
            ::.|.......|.........|...:|:::|.||....:|..|..|.||||:||||..||||||.
  Rat   218 KRLERLAIGFFPGSSQGCDAFLRHKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNH 282

  Fly   731 GYNFAEAVNFAPADWLKMGR---ECVNHYSMLR 760
            |:|.||:.|||...|:..|:   :|.....|::
  Rat   283 GFNCAESTNFATLRWIDYGKVATQCTCRKDMVK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lidNP_001245908.1 JmjN 160..201 CDD:128818
ARID 227..312 CDD:198082
PHD1_Lid_like 450..495 CDD:277078 5/9 (56%)
JmjC 624..740 CDD:202224 50/115 (43%)
zf-C5HC2 830..882 CDD:280996
PLU-1 896..1229 CDD:285609
PHD2_KDM5A 1295..1351 CDD:277079
PHD3_KDM5A_like 1755..1805 CDD:277083
Kdm4bNP_001037701.2 JmjN 15..56 CDD:128818 4/7 (57%)
JmjC 176..292 CDD:396791 50/115 (43%)
AvrE 475..>671 CDD:338078
PHD_SF 686..789 CDD:419867
ePHD_JMJD2B 798..907 CDD:277184
Tudor_JMJD2B_rpt1 920..973 CDD:410535
Tudor_SF 977..1032 CDD:413384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.