DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4A and Eif4a3

DIOPT Version :9

Sequence 1:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001093628.1 Gene:Eif4a3 / 688288 RGDID:1591139 Length:411 Species:Rattus norvegicus


Alignment Length:377 Identity:263/377 - (69%)
Similarity:321/377 - (85%) Gaps:0/377 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQ 91
            :|...||.|.|||:||||||.||||||||||||||...::|||||||:||||||||||||::||.
  Rat    35 DVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQC 99

  Fly    92 IDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTP 156
            :|..:||.||||||||||||.|||:.::|||:||.|..|||||||||.||.|.|:.|.|||.|||
  Rat   100 LDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTP 164

  Fly   157 GRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVS 221
            |||:|||.|:.|||:.||:.|||||||||::|||:||.||::.|||..||:|:|||:|.::||::
  Rat   165 GRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMT 229

  Fly   222 RCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLT 286
            ..||.||:.||||::||||||||||:|.|::|.||..|||||||||:|||:||||||:||||.||
  Rat   230 NKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLT 294

  Fly   287 QEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRE 351
            ::|...|||||:|||||.|::||.|||:||||:|||||:||:.|||:||.||||:||||||:|||
  Rat   295 EKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRE 359

  Fly   352 NYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403
            .|||||||.||:|||||||||:.:||.|||:||||:|.|.|:|||.|:||||
  Rat   360 LYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 261/375 (70%)
DEADc 32..232 CDD:238167 135/199 (68%)
Helicase_C 254..358 CDD:278689 76/103 (74%)
Eif4a3NP_001093628.1 PTZ00424 35..411 CDD:185609 261/375 (70%)
Q motif 38..66 21/27 (78%)
DEAD box. /evidence=ECO:0000305 187..190 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53631
OrthoDB 1 1.010 - - D321438at33208
OrthoFinder 1 1.000 - - FOG0000304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X250
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.