DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4A and CG7483

DIOPT Version :9

Sequence 1:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_649788.2 Gene:CG7483 / 40987 FlyBaseID:FBgn0037573 Length:399 Species:Drosophila melanogaster


Alignment Length:377 Identity:266/377 - (70%)
Similarity:322/377 - (85%) Gaps:0/377 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQ 91
            ||...|:.|||:||||||||.||||||||||||:|.|.|:||||||||||||||||||||:|||.
  Fly    23 EVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQS 87

  Fly    92 IDTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTP 156
            :||::||.|.|.|:||||||.|||:|::|||:.|.|..|.||||||:.||.|.|:.|.|:|.|||
  Fly    88 LDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVCIGGTNLGEDIRKLDYGQHIVSGTP 152

  Fly   157 GRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVS 221
            |||:|||.|:||||:.||:.|||||||||::|||:||.||::.|||..||:|:|||:|.::||::
  Fly   153 GRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMT 217

  Fly   222 RCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLT 286
            ..||.||:.||||::||||||||||:|.|::|.||..|||||||||:|||:||||||:||||.||
  Fly   218 SKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLT 282

  Fly   287 QEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRE 351
            ::|...|||||:|||||.|::|:.|||:||:|.||||||||:.||||||||||||||||||:|||
  Fly   283 EKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRE 347

  Fly   352 NYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI 403
            .|||||||.||||||||||||:..||.|||:||||:|.|.|:|||.|:||||
  Fly   348 LYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNVADLI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 264/375 (70%)
DEADc 32..232 CDD:238167 134/199 (67%)
Helicase_C 254..358 CDD:278689 78/103 (76%)
CG7483NP_649788.2 PTZ00424 4..399 CDD:185609 264/375 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451797
Domainoid 1 1.000 91 1.000 Domainoid score I403
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 257 1.000 Inparanoid score I117
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31736at7147
OrthoFinder 1 1.000 - - FOG0000304
OrthoInspector 1 1.000 - - otm46938
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X250
87.900

Return to query results.
Submit another query.