DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4A and Ddx1

DIOPT Version :9

Sequence 1:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_524212.2 Gene:Ddx1 / 40457 FlyBaseID:FBgn0015075 Length:727 Species:Drosophila melanogaster


Alignment Length:341 Identity:95/341 - (27%)
Similarity:165/341 - (48%) Gaps:57/341 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 QALILAPTRELATQIQRVVMALGEYM---KVHSHACIGGTNVREDARILESGCHVVVGTPGRVYD 161
            ||:|:.|:||||.|....:.....::   :|.|...|||..:.|....|..|.|:|||||||:.:
  Fly   288 QAIIMEPSRELAEQTYNQIEKFKYHLSNPEVRSLLLIGGVRLEEQKAQLMQGTHIVVGTPGRLEE 352

  Fly   162 MINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDVFKMLPP------DVQVILLSATMPP-DVLE 219
            |||..::...:.:.|||||||.:|.:|:.:.|..:.|.:|.      .:|:::.|||:.. :|.:
  Fly   353 MINSGLVLLTHCRFFVLDEADALLKQGYTELIDRLHKQIPKITSDGRRLQMVVCSATLHAFEVKK 417

  Fly   220 VSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQE---NW-------------------------- 255
            ::...|..|..:.:|.|:...|.:......|..:   .|                          
  Fly   418 MAERLMHFPTWVDLKGEDAVPETVHHVVCLVDPQMDTTWQSLRQPIGTDGVHDRDNVHPGNHSKE 482

  Fly   256 ------KL--GTLC-DLYDTLSITQSVIFCNTRRKVDQL---TQEMSIHNFTVSAMHGDMEQRDR 308
                  ||  |..| ...|..::.:::|||.|::..|.|   .::....:::...:|||.:.::|
  Fly   483 TLSQAVKLLKGEYCVHAIDKHNMDRAIIFCRTKQDCDNLERFLRQRGGKHYSCVCLHGDRKPQER 547

  Fly   309 EVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFI 373
            :..::.|:....:.||.||:.|||:|:..:..:||..||.::.||:|||||.||..|.|:||:.:
  Fly   548 KENLEMFKRQQVKFLICTDVAARGLDITGLPFMINVTLPDDKTNYVHRIGRVGRAERMGLAISLV 612

  Fly   374 TDDDRRILKDIEQFYH 389
            .....::      :||
  Fly   613 ATVPEKV------WYH 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 95/341 (28%)
DEADc 32..232 CDD:238167 47/141 (33%)
Helicase_C 254..358 CDD:278689 33/141 (23%)
Ddx1NP_524212.2 P-loop_NTPase 4..>62 CDD:304359
SPRY_DDX1 91..242 CDD:293933
SrmB 279..>612 CDD:223587 93/323 (29%)
P-loop_NTPase <280..426 CDD:304359 46/137 (34%)
Helicase_C 492..602 CDD:278689 34/109 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.