DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4A and CG5589

DIOPT Version :9

Sequence 1:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_649009.1 Gene:CG5589 / 39979 FlyBaseID:FBgn0036754 Length:594 Species:Drosophila melanogaster


Alignment Length:373 Identity:121/373 - (32%)
Similarity:189/373 - (50%) Gaps:24/373 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DNFD----DMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQ 90
            |:|.    |..:...|.:.:....|:.|:.||.:|:...::.|.::|.|.:|:|||..|...|:.
  Fly   115 DSFGTLTRDFKMLPRLQQNLLSRNFDHPTPIQMQALPVLLQRRALMACAPTGSGKTLAFLTPIIN 179

  Fly    91 QI----DTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGC-- 149
            .:    .|.:|   ||:||||||||.||.|....|.....:.:|..   :.|.|..:...:.|  
  Fly   180 GLRAHKTTGLR---ALVLAPTRELAQQIYRECAELTRETGLRTHFI---SKVSEAKQKHGAECKQ 238

  Fly   150 --HVVVGTPGRVYDMINRK--VLRTQYIKLFVLDEADEMLSRG---FKDQIQDVFKMLP-PDVQV 206
              .::|.||.||..::.::  :|...:::.|||||||.::..|   ||:|:.|::.... |...|
  Fly   239 RYDILVSTPNRVRFLLQQEPPLLDLSHVEWFVLDEADRLMEEGQNNFKEQLDDIYAACSNPTKCV 303

  Fly   207 ILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQ 271
            ...|||....|.:.:...:::.|.|.:..:....|.::|..:.|..|..||..:.||........
  Fly   304 AFFSATYTVPVAKWALRHLKNLVRITIGVQNSATETVQQELLFVGSEGGKLVAIRDLVRQGLQPP 368

  Fly   272 SVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQ 336
            .::|..::.:..||.:|:......|..:|.:..|..|:..:|.||.||..|||.|:|:.||||.:
  Fly   369 VLVFVQSKERAKQLFEELLYDGINVDVIHAERSQHQRDNCVKAFREGSIWVLICTELMGRGIDFK 433

  Fly   337 QVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDI 384
            .|:||||||.|....:|||||||.||.||.|.||.|.|.:|...|:.|
  Fly   434 GVNLVINYDFPPTTISYIHRIGRTGRAGRPGRAITFFTQEDTSNLRGI 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 121/373 (32%)
DEADc 32..232 CDD:238167 62/217 (29%)
Helicase_C 254..358 CDD:278689 38/103 (37%)
CG5589NP_649009.1 SrmB 87..594 CDD:223587 121/373 (32%)
P-loop_NTPase 123..329 CDD:304359 61/211 (29%)
HELICc 349..469 CDD:238034 49/119 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.