DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4A and CG6418

DIOPT Version :9

Sequence 1:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_648413.1 Gene:CG6418 / 39218 FlyBaseID:FBgn0036104 Length:791 Species:Drosophila melanogaster


Alignment Length:393 Identity:122/393 - (31%)
Similarity:203/393 - (51%) Gaps:37/393 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GPASMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQ 75
            ||:..:|   :.|..|..:|        |:|::.:....:.:|:.||.:|:...:.|||:|..|:
  Fly   261 GPSPPKP---VTSFGHFGFD--------EQLIKAVRKAEYTQPTPIQAQAVPTALSGRDIIGIAK 314

  Fly    76 SGTGKTATFSIAILQQI---------DTSIRECQALILAPTRELATQIQRVVMALGEYMKVHSHA 131
            :|:||||.|...:|..:         |..|    .|||||||||:.||.......|:...::...
  Fly   315 TGSGKTAAFIWPMLMHVMDQKQLKPGDGPI----GLILAPTRELSLQIYNEAKKFGKVYNLNVVC 375

  Fly   132 CIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDV 196
            |.||.:..|.::.||.|..::|.||||:.||:..|....:.:...||||||.|...||:.|::.:
  Fly   376 CYGGGSKWEQSKALEQGAEIIVATPGRMIDMVKMKATNLRRVTFLVLDEADRMFHMGFEPQVRSI 440

  Fly   197 FKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSIL-----VKKEELTLEGIKQFYVNVKQENWK 256
            ...:.||.|.::.|||....:..::|..:.|||.|:     ...:::| :.:..|...:::.|| 
  Fly   441 CNHVRPDRQCLMFSATFKKRIERLARDVLSDPVRIVQGDLNEANQDIT-QSVYVFPNPLQKWNW- 503

  Fly   257 LGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSR 321
              .||.|...||....:||...:...:.::..:.|..:....:||||:|.||..::.||:.....
  Fly   504 --LLCHLVKFLSEGSVLIFVTKKVDAETVSNNLLIKEYNCLLLHGDMDQADRNKVITQFKRKECD 566

  Fly   322 VLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDR----RILK 382
            :|:.||:.|||:|:..:..|:|||...:.|.:.|||||.||.|.||.|...:||.|:    .:::
  Fly   567 ILVATDVAARGLDIPHIRNVVNYDTARDIETHTHRIGRTGRAGEKGNAYTLVTDKDKEFAGHLVR 631

  Fly   383 DIE 385
            ::|
  Fly   632 NLE 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 122/393 (31%)
DEADc 32..232 CDD:238167 67/208 (32%)
Helicase_C 254..358 CDD:278689 33/103 (32%)
CG6418NP_648413.1 DEADc 271..475 CDD:238167 69/215 (32%)
DEXDc 284..489 CDD:214692 67/209 (32%)
Helicase_C 504..609 CDD:278689 36/104 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451734
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.