DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4A and CG9253

DIOPT Version :9

Sequence 1:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_610090.1 Gene:CG9253 / 35379 FlyBaseID:FBgn0032919 Length:507 Species:Drosophila melanogaster


Alignment Length:388 Identity:121/388 - (31%)
Similarity:209/388 - (53%) Gaps:5/388 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DDRNEIPQDGPASMEPE---GVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIP 63
            :|.|....|..|::..|   |..:....|....:.|:.|.|.|.:......::.||.||:.||..
  Fly    30 EDNNHKEGDSEAALSGEDDKGSEDDAAEEQKLTWKDLGLNEALCQACDELKWKAPSKIQREAIPV 94

  Fly    64 CVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYMKVH 128
            .::|:|||..|::|:|||..|::.||..:..:.:...||:|.||||||.||.....|||..:.:.
  Fly    95 ALQGKDVIGLAETGSGKTGAFALPILHALLENPQRYFALVLTPTRELAFQIGEQFEALGSGIGIK 159

  Fly   129 SHACIGGTNVREDARILESGCHVVVGTPGRVYDMI-NRKVLRTQYIKLFVLDEADEMLSRGFKDQ 192
            ....:||.::......|....|:::.||||:.|.: |.|....:.||..|:||||.:|:..|:.:
  Fly   160 CCVVVGGMDMVAQGLQLAKKPHIIIATPGRLVDHLENMKGFNLKAIKYLVMDEADRILNMDFEVE 224

  Fly   193 IQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKL 257
            :..:.|:||.:.:..|.||||...|.::.|..::|||.:.|..:..|:|.::|.|:.:..: :|.
  Fly   225 LDKILKVLPRERRTFLFSATMTKKVKKLQRASLKDPVKVEVSNKYQTVEQLQQSYLFIPVK-YKD 288

  Fly   258 GTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRV 322
            ..|..:.:.|:....:|||:|.....:....:.........:||.|.|..|...:.:|::.:..:
  Fly   289 VYLVHILNELAGNSFMIFCSTCNNTVKTALMLRALGLAAIPLHGQMSQNKRLAALNKFKAKNRSI 353

  Fly   323 LITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIE 385
            ||:||:.:||:|:..|.:|:|:|:|::.::||||:||..|.||.|.||..::..|..:.:.||
  Fly   354 LISTDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITLVSQYDIELYQRIE 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 119/384 (31%)
DEADc 32..232 CDD:238167 69/200 (35%)
Helicase_C 254..358 CDD:278689 29/103 (28%)
CG9253NP_610090.1 SrmB 34..498 CDD:223587 119/384 (31%)
DEADc 63..264 CDD:238167 69/200 (35%)
HELICc 274..403 CDD:238034 39/129 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.