DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4A and CG10333

DIOPT Version :9

Sequence 1:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_609888.2 Gene:CG10333 / 35112 FlyBaseID:FBgn0032690 Length:822 Species:Drosophila melanogaster


Alignment Length:435 Identity:130/435 - (29%)
Similarity:215/435 - (49%) Gaps:57/435 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DDRNEIPQDGPASMEPEGVIESTW---HEVYD-------------NFDDMNLREELLRGIYGYGF 50
            |||:.      :..|.:.:.|..|   .|.|:             ::::....:|::..|...|:
  Fly   356 DDRHW------SEKENDEMTERDWRIFREDYNVTIKGGRIPNPIRSWNESGFPKEIIDIIDKVGY 414

  Fly    51 EKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDT--SIRECQ-------ALILAP 106
            ::|:.||::||...::.||:|..|::|:|||..|.|.:|..|.:  .|...:       |:|:||
  Fly   415 KEPTPIQRQAIPIGLQNRDIIGVAETGSGKTLAFLIPLLSWIQSLPKIERLEDVDQGPYAIIMAP 479

  Fly   107 TRELATQIQRVVMALGEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQ 171
            |||||.||:......|:.:.:.:...:||.:..|....|..||.:|:.||||:.|::..:.|...
  Fly   480 TRELAQQIEEETTKFGQPLGIRTVVVVGGLSREEQGFRLRLGCEIVIATPGRLIDVLENRYLVLN 544

  Fly   172 YIKLFVLDEADEMLSRGFKDQIQDVFKMLP-----PDV--------------------QVILLSA 211
            .....||||||.|:..||:..:|.:.:.:|     ||.                    |.::.:|
  Fly   545 QCTYIVLDEADRMIDMGFEPDVQKILEYMPVTNLKPDTEEAEDETKLMENFYTKKKYRQTVMFTA 609

  Fly   212 TMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFC 276
            ||||.|..::|.::|.|.::.:.......|..:|. |.:..||.|...|.::.........:||.
  Fly   610 TMPPAVERLARTYLRRPATVYIGSVGKPTERTEQI-VYMMGENDKRKKLMEILSRKIDPPVIIFV 673

  Fly   277 NTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLV 341
            |.::..|.|.:.:....:....:||...|..||..:...:||:..:|:.||:..||||::.||||
  Fly   674 NQKKGADVLAKGLEKLGYNSCTLHGGKGQEQREYALAALKSGAKDILVATDVAGRGIDIKDVSLV 738

  Fly   342 INYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQ 386
            ||||:....|:|.|||||.||.|:.|.||:|:|.||..:..|::|
  Fly   739 INYDMAKTIEDYTHRIGRTGRAGKTGCAISFVTKDDSALFYDLKQ 783

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 127/431 (29%)
DEADc 32..232 CDD:238167 69/233 (30%)
Helicase_C 254..358 CDD:278689 34/103 (33%)
CG10333NP_609888.2 DEADc 396..629 CDD:238167 69/232 (30%)
DEXDc 409..632 CDD:214692 68/222 (31%)
Helicase_C 651..761 CDD:278689 39/109 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.