DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4A and CG5800

DIOPT Version :9

Sequence 1:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster


Alignment Length:434 Identity:112/434 - (25%)
Similarity:200/434 - (46%) Gaps:65/434 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RNEIPQDGPASMEPE--------GVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRA 60
            |.||.:...|:.|.|        ..|::|   ....|....|.::..:.:....|..|:.:|:.:
  Fly    41 RQEINKSRLAATEAEIQDLKTKYAEIDAT---AIKKFAQFPLSKKTQKALAESKFVHPTQVQRDS 102

  Fly    61 IIPCVRGRDVIAQAQSGTGKTATFSIAILQQID----TSIRECQALILAPTRELATQIQRVVMAL 121
            |.|.::|:||:..|.:|:|||..|.|.:|:.:.    :......|:|::||||||.||...:..:
  Fly   103 IGPALQGKDVLGAAITGSGKTLAFLIPVLEHLFMNKWSRTDGVGAIIISPTRELAYQIFETLKKV 167

  Fly   122 GEYMKVHSHACIGGTNVREDARILESGCHVVVGTPGRVYD-MINRKVLRTQYIKLFVLDEADEML 185
            |::....:...|||.|::.:...::. |::::.||||:.. |....:..|..:::.||||||..|
  Fly   168 GKHHDFSAGLIIGGKNLKFERTRMDQ-CNILICTPGRLLQHMDENPLFNTSTMEMLVLDEADRCL 231

  Fly   186 SRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPV-------------SILVKKEE 237
            ..||:..:..:.:..||..|.:|.|||....|.:::|..::|||             |...||..
  Fly   232 DMGFQKTLNSIIENFPPVRQTLLFSATQTNTVQDLARLNLKDPVYVGYGGATPREEPSASTKKTP 296

  Fly   238 LTL-----EGIKQFYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRK----VDQLTQEMSIHN 293
            .|.     |.::|.||           :.:|.|.:::..|.|..:.::|    |....|...::.
  Fly   297 NTAVLAVPELLQQSYV-----------VLNLEDKITMLWSFIKNHLKQKIIVFVASCKQAKYLYE 350

  Fly   294 F--------TVSAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNR 350
            .        .:.|::|.:.|..|..|.:.|...|..|:.:||:.:||:|...|:.|:..|.|.:.
  Fly   351 IFCKLRPGSPLLALYGTLHQDRRIAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDV 415

  Fly   351 ENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEE 394
            ..||||.||..|...:|..:..:|..:       |::..:.::|
  Fly   416 SQYIHRAGRSARNKTRGECLLVLTPSE-------EEYMISALKE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 111/432 (26%)
DEADc 32..232 CDD:238167 62/217 (29%)
Helicase_C 254..358 CDD:278689 28/115 (24%)
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 112/434 (26%)
DEADc 74..277 CDD:238167 61/203 (30%)
HELICc 311..437 CDD:238034 34/136 (25%)
DUF4217 474..530 CDD:290667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24031
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.