DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4A and mahe

DIOPT Version :9

Sequence 1:NP_001245907.1 Gene:eIF4A / 33835 FlyBaseID:FBgn0001942 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001284994.1 Gene:mahe / 31707 FlyBaseID:FBgn0029979 Length:945 Species:Drosophila melanogaster


Alignment Length:402 Identity:136/402 - (33%)
Similarity:214/402 - (53%) Gaps:39/402 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NEIPQDGPASMEPEGVIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRD 69
            ||:|                 |.|. :|::.:|...::..:...||.||:|||.:.....:.|||
  Fly   230 NELP-----------------HPVV-SFEESSLPAHVIEEMKRQGFTKPTAIQSQGWPIALSGRD 276

  Fly    70 VIAQAQSGTGKTATFSIAILQQIDTSIRECQ-----ALILAPTRELATQIQRVVMALGEYMKVH- 128
            ::..||:|:|||..:.:..:..|.......:     ||:||||||||.|||.||...|...|.. 
  Fly   277 LVGIAQTGSGKTLAYMLPAIVHIGNQPPIIRGEGPIALVLAPTRELAQQIQSVVRDYGHLCKPEI 341

  Fly   129 SHACI-GGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQ 192
            .|.|| ||::....||.|:.|..|::.||||:.|.:..:....|.....||||||.||..||:.|
  Fly   342 RHTCIFGGSSKVPQARDLDRGVEVIIATPGRLIDFLENRNTNLQRCTYLVLDEADRMLDMGFEPQ 406

  Fly   193 IQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTL-EGIKQFYVNVKQENWK 256
            |:.:.:.:.||.||::.|||.|.:|..::..|:.|.:.|.:....|:. ..|:|. |.:..|..|
  Fly   407 IRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGSMNLSANHNIRQI-VEICTEIEK 470

  Fly   257 LGTLCDLYDTLSITQS--------VIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQRDREVIMK 313
            ...|..|.:.:|..::        ::|..|:.||:.:.|.:....:..:::|||..|.:|:.::|
  Fly   471 PQRLVCLLNEISPIKNSGNNGNKIIVFVETKIKVEDILQIIRAEGYNATSIHGDKTQNERDSVLK 535

  Fly   314 QFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINFITDDD- 377
            .||:|.|.:||.||:.:||:||:.:..|||||.|::.|||:|||||.||..:.|.|..|.|.|: 
  Fly   536 DFRNGKSNILIATDVASRGLDVEDLQYVINYDYPNSSENYVHRIGRTGRCQQLGTAYTFFTPDNA 600

  Fly   378 ---RRILKDIEQ 386
               |.::..:|:
  Fly   601 KQARELISVLEE 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4ANP_001245907.1 PTZ00424 6..403 CDD:185609 135/401 (34%)
DEADc 32..232 CDD:238167 75/206 (36%)
Helicase_C 254..358 CDD:278689 38/111 (34%)
maheNP_001284994.1 PTZ00110 136..656 CDD:240273 136/402 (34%)
DEADc 239..446 CDD:238167 75/206 (36%)
HELICc 457..594 CDD:238034 49/137 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451761
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.