DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and PFY1

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_014765.3 Gene:PFY1 / 854289 SGDID:S000005648 Length:126 Species:Saccharomyces cerevisiae


Alignment Length:127 Identity:50/127 - (39%)
Similarity:73/127 - (57%) Gaps:2/127 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSWQDYVDNQLLASQCVTKACIAGHDGN-IWAQSSGFEVTKEELSKLISGFDQQDGLTSNGVTLA 64
            ||||.|.|| |:.:..|.||.|....|: :||.|.|..:...|:.:::.|||...||.|||:.:.
Yeast     1 MSWQAYTDN-LIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNGLHIQ 64

  Fly    65 GQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYLITCGY 126
            ||:::.|...||.:..:....||.|::|.|.||::.|...||..:|..:||:|.||||...|
Yeast    65 GQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADYLIGVQY 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 49/125 (39%)
PFY1NP_014765.3 Profilin 1..123 CDD:395179 48/122 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346705
Domainoid 1 1.000 95 1.000 Domainoid score I1675
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40274
Inparanoid 1 1.050 94 1.000 Inparanoid score I1509
Isobase 1 0.950 - 0 Normalized mean entropy S2356
OMA 1 1.010 - - QHG53820
OrthoFinder 1 1.000 - - FOG0002709
OrthoInspector 1 1.000 - - oto99302
orthoMCL 1 0.900 - - OOG6_101239
Panther 1 1.100 - - LDO PTHR11604
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R984
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.