DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and PFN2

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_194664.1 Gene:PFN2 / 829056 AraportID:AT4G29350 Length:131 Species:Arabidopsis thaliana


Alignment Length:130 Identity:53/130 - (40%)
Similarity:77/130 - (59%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSWQDYVDNQLLA---SQCVTKACIAGHDGNIWAQSSGF-EVTKEELSKLISGFDQQDGLTSNGV 61
            ||||.|||:.|:.   ...:|.|.|.|.||::|||||.| ::...|::.:...|::...|...|:
plant     1 MSWQSYVDDHLMCEVEGNHLTHAAIFGQDGSVWAQSSAFPQLKPAEIAGINKDFEEAGHLAPTGL 65

  Fly    62 TLAGQRYIYLSG-TDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYLITCG 125
            .|.|::|:.:.| ...|:|.|.|..||...|||||::..||::|:...|...|||:||||||..|
plant    66 FLGGEKYMVVQGEAGAVIRGKKGPGGVTIKKTTQALVFGIYDEPMTGGQCNLVVERLGDYLIESG 130

  Fly   126  125
            plant   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 53/130 (41%)
PFN2NP_194664.1 Profilin 1..128 CDD:395179 51/126 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I2250
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I2147
OMA 1 1.010 - - QHG53820
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 1 1.000 - - FOG0002709
OrthoInspector 1 1.000 - - otm2534
orthoMCL 1 0.900 - - OOG6_101239
Panther 1 1.100 - - O PTHR11604
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4911
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.