DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and Pfn2

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_110500.2 Gene:Pfn2 / 81531 RGDID:621826 Length:140 Species:Rattus norvegicus


Alignment Length:120 Identity:34/120 - (28%)
Similarity:55/120 - (45%) Gaps:37/120 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WQDYVDNQLLASQCVTKACIAGH-DGN-IWAQSSG--FE-VTKEELSKLISGFDQQDGLTSNGVT 62
            ||.|||| |:...|..:|.|.|: |.. :||.::|  |: :|..|:..:| |.| ::|..:||:|
  Rat     4 WQSYVDN-LMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPAEIDVII-GKD-REGFFTNGLT 65

  Fly    63 LAGQR------YIYLSG-----------------------TDRVVRAKLGRSGVH 88
            |.|::      .:|:..                       ..||:...:|:.|||
  Rat    66 LGGKKCSVIRDSLYVDSDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 34/120 (28%)
Pfn2NP_110500.2 PROF 2..140 CDD:214646 34/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.