DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and Pfn3

DIOPT Version :10

Sequence 1:NP_477016.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001102957.1 Gene:Pfn3 / 685936 RGDID:1587838 Length:137 Species:Rattus norvegicus


Alignment Length:134 Identity:32/134 - (23%)
Similarity:55/134 - (41%) Gaps:37/134 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WQDYVDNQLLASQCVTKACIAGHDGN--IWAQSSG---FEVTKEELSKLISGFDQQDGLTSNGVT 62
            |:.|: :.:|..|.:....|.||..|  :||...|   ..::.:|:. :::|.|:...| ..|::
  Rat     4 WKGYI-SAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVG-VLTGPDRHTFL-QTGLS 65

  Fly    63 LAGQR------YIYLSG--------------------TDRVVRAKLGRSGVH---CMKTTQAVIV 98
            :||:|      |:...|                    |.|.:...:||.|||   ..||...:|.
  Rat    66 VAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGILNKTVHDLIG 130

  Fly    99 SIYE 102
            .:.|
  Rat   131 GLRE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_477016.1 Profilin 1..122 CDD:459724 32/134 (24%)
Pfn3NP_001102957.1 PROF 3..137 CDD:238085 32/134 (24%)

Return to query results.
Submit another query.