DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and Pfn1

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_071956.2 Gene:Pfn1 / 64303 RGDID:621825 Length:140 Species:Rattus norvegicus


Alignment Length:119 Identity:25/119 - (21%)
Similarity:44/119 - (36%) Gaps:35/119 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WQDYVDNQLLASQCVTKACIAGHDG-NIWAQSSG---FEVTKEELSKLISGFDQQDGLTSNGVTL 63
            |..|:|:.:....|...|.:...|. ::||...|   ..:|..|:..|: |.|:..... ||:||
  Rat     4 WNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLV-GKDRSSFFV-NGLTL 66

  Fly    64 AGQR-----------------------------YIYLSGTDRVVRAKLGRSGVH 88
            .||:                             .:.::.|.:.:...:|:.|||
  Rat    67 GGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 25/119 (21%)
Pfn1NP_071956.2 PROF 2..140 CDD:214646 25/119 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.