DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and pfn2

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001016098.1 Gene:pfn2 / 548852 XenbaseID:XB-GENE-945004 Length:140 Species:Xenopus tropicalis


Alignment Length:120 Identity:35/120 - (29%)
Similarity:53/120 - (44%) Gaps:37/120 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WQDYVDNQLLASQCVTKACIAGH-DGN-IWAQSSG--FE-VTKEELSKLISGFDQQDGLTSNGVT 62
            |||||| .|:|.....:|.|.|: |.. :||.:.|  |: :|..|:..|| |.| ::|..:.|:|
 Frog     4 WQDYVD-MLMADGSCQEAAIVGYVDAKYVWATTPGGIFQIITPAEIDVLI-GKD-REGFFTGGLT 65

  Fly    63 LAGQR--------YI------------------YLSGTDRVVRA---KLGRSGVH 88
            :.|::        ||                  |.....:.||.   .:|:.|||
 Frog    66 VGGKKCSVIRDSLYIDNDFTMDIRTKSQGGEPTYNIAVGKAVRVLVFAMGKEGVH 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 35/120 (29%)
pfn2NP_001016098.1 PROF 2..140 CDD:214646 35/120 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.