DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and Pfn4

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001009503.1 Gene:Pfn4 / 494222 RGDID:1359707 Length:129 Species:Rattus norvegicus


Alignment Length:122 Identity:34/122 - (27%)
Similarity:55/122 - (45%) Gaps:6/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YVDNQLLASQCVTK-----ACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLT-SNGVTLA 64
            ::.|.||.:...||     |.|...:..:...|.||.|...::..|::||.:...|| ..|:...
  Rat     3 HLQNLLLDTLLGTKHVDGAALIKLQEKTLCVTSPGFSVMPCDVRTLLNGFAKNPLLTRREGLYFR 67

  Fly    65 GQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYL 121
            .:.|..:...|..:.||...:||..:||...::|:.|...:.|.......||||:||
  Rat    68 EKDYKCVRADDCSLYAKKENTGVVVVKTHMYLLVATYTAGMYPSVCVEATEKLGEYL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 34/122 (28%)
Pfn4NP_001009503.1 Profilin 14..126 CDD:395179 31/111 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347500
Domainoid 1 1.000 40 1.000 Domainoid score I12234
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 40 1.000 Inparanoid score I5411
OMA 1 1.010 - - QHG53820
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 1 1.000 - - FOG0002709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101239
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.